PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01949.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 784aa    MW: 86290.8 Da    PI: 9.4674
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01949.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.12.3e-053463771338
                      zf-B_box  13 elqlfCedCqqllCedClleeHkg......Ht 38 
                                   +++++C  ++ +lC+ C  + H+       H+
  Zmw_sc01949.1.g00050.1.am.mk 346 RARWYCAADDAFLCQACDASVHSAnplarrHE 377
                                   589*******************6566766776 PP

2CCT66.85.9e-23720762143
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                                   Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk+
  Zmw_sc01949.1.g00050.1.am.mk 720 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR 762
                                   9****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0079339381IPR000315B-box-type zinc finger
CDDcd000212.46E-6346381No hitNo description
PfamPF062031.1E-17720762IPR010402CCT domain
PROSITE profilePS5101715.993720762IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 784 aa     Download sequence    Send to blast
MLDRPAHGGA ASLRRLASAI PSEGLTAPRH PQAARSVRRR ELLLPSNPID RRGRARANPG  60
LYEHLPDAGW LGLGTALRST LVGRTAHCGA AAAVRRSPAK WQVNARIWAR AEQDRRVQVL  120
YLRHRIKVPV VSCRGWLRAL YNGSAWDEEE GKRHRSAPSL PRRGEGGNAW SERDAAVGLD  180
FGIVGFEKTQ RHETSLLQAP VQRINTTAQP SLAYYNTDTG RALRPVTSPR QRWRHRIRPT  240
PGCGTGYTPG WEGARRIVVM CFLEGWTKGW ARHPSRGPRK NPGLSNGISQ NWIRYFQRTN  300
CVSDKACAWA LTSTMKVEST LVTAAETHEQ QFDSGGGRRR GXXXXRARWY CAADDAFLCQ  360
ACDASVHSAN PLARRHERLR LRPTSPPPHE SSLDQAIAAR STSTQRRPVA PAWSRRKARS  420
RRPQVKSVGQ LLSRKLVVPE LAAESSEERK AEEDGSEETQ LLCHRVPSFD RALAELCSPL  480
PVDDAAAAAS SSRDNINGAM EDASKQDSVD ATSSPVQQLP DSLSGFGPTD AELSEFAADM  540
EALLGQGMDD SNELDESFYM ESLGLMTPAE DDGGRVKMEP HGDISNCDGA LGIGRHTDMK  600
SVASAEVLDI DSKIPNCCSP TAVDDEDYED SFEQKAPMAS NGDAPDAQFL RRSLDLRLNY  660
EAIIESWGTS PWTDGQRPCV RLDDFWPHHA YHSGEWTPGG GQPPGVGPLT PPRWGTDGCR  720
EARVSRYREK RRTRLFAKKI RYEVRKLNAE KRPRMKGRFV KRPGAGAGGG AAVTPAAPCA  780
VTST
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1730746RRTRLFAKKIRYEVRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661075.11e-173PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform X1
TrEMBLK3YS801e-173K3YS80_SETIT; Uncharacterized protein
STRINGSi017124m1e-173(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32833058